Calcitonin (porcine) trifluoroacetate salt
H-Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Ser-Ala-Tyr-Trp-Arg-Asn-Leu-Asn-Asn-Phe-His-Arg-Phe-Ser-Gly-Met-Gly-Phe-Gly-Pro-Glu-Thr-Pro-NH₂ trifluoroacetate salt (Disulfide bond)
Catalog # | Pkg Size | Price(USD) | Quantity | Buy this product |
---|---|---|---|---|
R-M-720 | 1mg | 150.00 | + Add to cart |
|
R-M-720 | 5mg | 625.00 | + Add to cart |
|
|
Product description
Calcitonin (porcine) trifluoroacetate salt,CAS :12321-44-7 from ruixi.It is a synthetic peptide.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Cas | 12321-44-7 |
Sequence | CSNLSTCVLSAYWRNLNNFHRFSGMGFGPETP-NH₂ |
Molecular Formula | C₁₅₉H₂₃₂N₄₆O₄₅S₃ |
Storage | -20℃,protected from light and moisture |
Transportation | 4-25℃ temperature for up to 2 weeks |
Stability | 1 year |
Document
Related Product